PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM11G16300.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 409aa    MW: 43912.9 Da    PI: 8.8111
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM11G16300.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC71.97.2e-23159202245
              WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                       ep+rCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  OGLUM11G16300.2 159 VEPRRCRRTDGKKWRCSRDAVGDQKYCERHINRGRHRSRKHVEG 202
                      59***************************************996 PP

2QLQ58.12.6e-20106142137
              QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      ++FT++Q+++L++Q+l+yK++aan+ vP+ Ll++i++
  OGLUM11G16300.2 106 GPFTPTQWMELEHQALIYKHIAANVSVPSSLLLPIRR 142
                      59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.4E-12106142IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.888107142IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-14107141IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.136158202IPR014977WRC domain
PfamPF088793.5E-19160201IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MLSSCGGHGH GNPRSLQEEH HGRCGEQQGG GGGGGQEQEQ DGFLVREARA SPPSPSSSSF  60
LGSTSSSCSG GGGGGQMLSF SSPNGTAGLG LSSGGSMQGV LARVRGPFTP TQWMELEHQA  120
LIYKHIAANV SVPSSLLLPI RRSLHPWGWG SFPPGCADVE PRRCRRTDGK KWRCSRDAVG  180
DQKYCERHIN RGRHRSRKHV EGRKATLTIA EPSMVIAAGV SSRGHAVARQ KQVKGSAATV  240
SDPFSRQSNR KFLEKQNVVD QLSPMDSFDF SSTQSSPNYD NVALSPLKLH HDHDESYIGH  300
GLGSSSEKGS MMHESRLTVS KETLDDGPLG EVFKRKNCQS ASTEILTEKW TENPNLHCPS  360
GILQMATKFN SISSGNTVNS GGTAVENLIT DNGYLTARMM NPHIVPTLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1030550.0AK103055.1 Oryza sativa Japonica Group cDNA clone:J033117J15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615703.10.0PREDICTED: growth-regulating factor 8
SwissprotQ6AWY10.0GRF8_ORYSJ; Growth-regulating factor 8
TrEMBLA0A0E0BK680.0A0A0E0BK68_9ORYZ; Uncharacterized protein
STRINGLOC_Os11g35030.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129602731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-38growth-regulating factor 2